PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_028753
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family WRKY
Protein Properties Length: 295aa    MW: 32740.1 Da    PI: 4.5999
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_028753genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.35.8e-32117173258
                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                  dDgy+WrKYGqK++k+s +prsYYrCt ++C++kk+vers++dp++++itYeg H h
  DCAR_028753 117 DDGYKWRKYGQKSIKNSSNPRSYYRCTNPHCSAKKQVERSTDDPDTIIITYEGLHLH 173
                  8******************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.5E-29110173IPR003657WRKY domain
PROSITE profilePS5081126.647111173IPR003657WRKY domain
SuperFamilySSF1182908.76E-27114173IPR003657WRKY domain
SMARTSM007744.8E-35116175IPR003657WRKY domain
PfamPF031061.5E-25117173IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MDTTWLEDEL VRELLDDDSP LFILPCEEEN DMSTGSNSSN YYSSYSFLDQ LVSGSGILSE  60
QTVESDSRSL TSNNYPSSYM QELLLATSRN SLLERGMCKS ESKYTLRIKS SGNVISDDGY  120
KWRKYGQKSI KNSSNPRSYY RCTNPHCSAK KQVERSTDDP DTIIITYEGL HLHFTYPFLK  180
LGQTDSTGPV TKKPKLSSPI DEAHVDDTQR TKEKEPGYTS AGPDVVTDLA QDEVGLGPQG  240
LLEDMVPFVV RNPQINTSSS HSSSVSSCPS PPTSPLSFSW SPPHYSNLYF DMGL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A6e-201171731874Probable WRKY transcription factor 4
1wj2_A6e-201171731874Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003530211.26e-77PREDICTED: probable WRKY transcription factor 49
TrEMBLA0A0S3RV606e-78A0A0S3RV60_PHAAN; Uncharacterized protein
TrEMBLA0A0L9U5C76e-78A0A0L9U5C7_PHAAN; Uncharacterized protein
STRINGGLYMA07G16040.22e-76(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA120752124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.11e-39WRKY DNA-binding protein 49